Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CROCCL2 Rabbit Polyclonal Antibody (HRP)

CROCCL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CROCCL2, dJ798A10.2

UniProt

Q8IVE0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CROCCL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NPEKDQVNTDLTEKLEALGTWHSPSCRTQSGVQLSGSERTADDSFGSLRG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_057040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS711729 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
SIRT1/2 Inhibitor IV, Cambinol
TRC-S487905-10MG 10 mg

SIRT1/2 Inhibitor IV, Cambinol

Sign In for Pricing
View Details
Goat Polyclonal Antibody
TA398271 1 mg

Goat Polyclonal Antibody

Sign In for Pricing
View Details
GPR107 Human Gene Knockout Kit (CRISPR)
KN421989 1 Kit

GPR107 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-T + Cad Salvia horminum Lectin -SHA-
B-3401-2 2 mL

Anti-T + Cad Salvia horminum Lectin -SHA-

Sign In for Pricing
View Details
MCP1 (CCL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G4]
TA805016BM 100 µL

MCP1 (CCL2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G4]

Sign In for Pricing
View Details