Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT9 Rabbit Polyclonal Antibody (HRP)

SEPT9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSF, MSF1, NAPB, SEPT9, SINT1, PNUTL4, SeptD1, AF17q25

UniProt

Q9UHD8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SEPT9 (septin 9)

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFPL4B Rabbit Polyclonal Antibody
TA356282 100 µL

RFPL4B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Col7a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6709008 1.0 µg DNA

Col7a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
GJA3 Human shRNA Plasmid Kit (Locus ID 2700)
TL316555 1 Kit

GJA3 Human shRNA Plasmid Kit (Locus ID 2700)

Sign In for Pricing
View Details
FAM73B ORF Vector (Human) (pORF)
20104011 1.0 µg DNA

FAM73B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Rabbit Anti-Human NTS pAb
PA5976-01 50 μL

Rabbit Anti-Human NTS pAb

Sign In for Pricing
View Details
Rabbit Anti-Human NTS pAb
PA5976-02 100 μL

Rabbit Anti-Human NTS pAb

Sign In for Pricing
View Details