Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT9 Rabbit Polyclonal Antibody (HRP)

SEPT9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSF, MSF1, NAPB, SEPT9, SINT1, PNUTL4, SeptD1, AF17q25

UniProt

Q9UHD8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SEPT9 (septin 9)

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001106968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prox1 (NM_001107201) Rat Tagged ORF Clone
RR202625 10 µg

Prox1 (NM_001107201) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Human CRIP3 Protein Lysate
MBS139908-01 0.02 mg

Human CRIP3 Protein Lysate

Sign In for Pricing
View Details
Human CRIP3 Protein Lysate
MBS139908-02 5x 0.02 mg

Human CRIP3 Protein Lysate

Sign In for Pricing
View Details
Lentiviral human NEPRO sgRNA gene knockout kit - Lentiviral human NEPRO sgRNA gene knockout kit (25)
GTR15367461 1 Vial

Lentiviral human NEPRO sgRNA gene knockout kit - Lentiviral human NEPRO sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human IL-3 Recombinant Protein C-6 His Tag Lyophilized
MBS8432486-01 0.05 mg

Human IL-3 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details
Human IL-3 Recombinant Protein C-6 His Tag Lyophilized
MBS8432486-02 5x 0.05 mg

Human IL-3 Recombinant Protein C-6 His Tag Lyophilized

Sign In for Pricing
View Details