Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADA Rabbit Polyclonal Antibody (HRP)

ADA Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADA1

UniProt

P00813

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADA

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000013

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibronectin Type III Domain Containing Protein 3A (FNDC3A) ELISA Kit
abx387392 96 Tests

Human Fibronectin Type III Domain Containing Protein 3A (FNDC3A) ELISA Kit

Sign In for Pricing
View Details
BC032203 Protein Vector (Mouse) (pPM-C-His)
PV158665 500 ng

BC032203 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Mouse Monoclonal OX40/TNFRSF4 Antibody (977960) [DyLight 680]
FAB10542Y 0.1 mL

Mouse Monoclonal OX40/TNFRSF4 Antibody (977960) [DyLight 680]

Sign In for Pricing
View Details
CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200) (MaxLight 750) discontinued
C2400-30-ML750 100 µL

CD45RA (Leukocyte Common Antigen, LCA, Ly-5 T200) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Phospho-CAMK2A (Thr286) Antibody
CSB-PA293488 100 µL

Phospho-CAMK2A (Thr286) Antibody

Sign In for Pricing
View Details
ECE2 (Endothelin-Converting Enzyme 2, ECE-2, Methyltransferase-like Region, 211-, Endothelin-Converting Enzyme 2 Region, ECE2, KIAA0604) (MaxLight 650) discontinued
302404-ML650 100 µL

ECE2 (Endothelin-Converting Enzyme 2, ECE-2, Methyltransferase-like Region, 211-, Endothelin-Converting Enzyme 2 Region, ECE2, KIAA0604) (MaxLight 650) discontinued

Sign In for Pricing
View Details