Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AHCY Rabbit Polyclonal Antibody (HRP)

AHCY Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAHH, adoHcyase

UniProt

P23526

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human AHCY

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIA

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000678

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nectin 1 (Poliovirus Receptor-related Protein, PRR, PVRL1, PRR1, Vec C, CD111, HveC, HigR) (MaxLight 650)
MBS6259871-01 0.1 mL

Nectin 1 (Poliovirus Receptor-related Protein, PRR, PVRL1, PRR1, Vec C, CD111, HveC, HigR) (MaxLight 650)

Sign In for Pricing
View Details
Nectin 1 (Poliovirus Receptor-related Protein, PRR, PVRL1, PRR1, Vec C, CD111, HveC, HigR) (MaxLight 650)
MBS6259871-02 5x 0.1 mL

Nectin 1 (Poliovirus Receptor-related Protein, PRR, PVRL1, PRR1, Vec C, CD111, HveC, HigR) (MaxLight 650)

Sign In for Pricing
View Details
Mouse Wfdc10 qPCR Primer Pair
QM76506S 200 Tests

Mouse Wfdc10 qPCR Primer Pair

Sign In for Pricing
View Details
LENEP Rabbit Polyclonal Antibody (Biotin)
orb451169 100 µL

LENEP Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LOC681761 3'UTR GFP Stable Cell Line
TU260808 1.0 mL

LOC681761 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Sheep Cytochrome b561 domain-containing protein 2 (CYB561D2) ELISA Kit
MBS7213512-01 48 Well

Sheep Cytochrome b561 domain-containing protein 2 (CYB561D2) ELISA Kit

Sign In for Pricing
View Details