Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP27A1 Rabbit Polyclonal Antibody (HRP)

CYP27A1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CTX, CP27, CYP27

UniProt

Q02318

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human CP27A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPE

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apg12 (ATG12) Goat Polyclonal Antibody
AB0083-200 600 µg

Apg12 (ATG12) Goat Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Human CD41 Antibody[10E5-F0061]
AN00332E-01 20 Tests

APC Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
APC Anti-Human CD41 Antibody[10E5-F0061]
AN00332E-02 100 Tests

APC Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
APC Anti-Human CD41 Antibody[10E5-F0061]
AN00332E-03 2x 100 Tests

APC Anti-Human CD41 Antibody[10E5-F0061]

Sign In for Pricing
View Details
Camsap1 Mouse Gene Knockout Kit (CRISPR)
KN502490 1 Kit

Camsap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL
BNC882883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details