Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCK Rabbit Polyclonal Antibody (HRP)

DCK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC117410, MGC138632

UniProt

P27707

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DCK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_000779

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-IRF3 (Ser396) Blocking Peptide
MBS9615237-01 1 mg

Phospho-IRF3 (Ser396) Blocking Peptide

Sign In for Pricing
View Details
Phospho-IRF3 (Ser396) Blocking Peptide
MBS9615237-02 5x 1 mg

Phospho-IRF3 (Ser396) Blocking Peptide

Sign In for Pricing
View Details
Foravirumab (Anti-Rabies virus GP)
A3125-1mg*25 25x 1 mg

Foravirumab (Anti-Rabies virus GP)

Sign In for Pricing
View Details
COG3, CT (COG3, SEC34, Conserved oligomeric Golgi complex subunit 3, Component of oligomeric Golgi complex 3, Vesicle-docking protein SEC34 homolog, p94) (MaxLight 405)
MBS6287531-01 0.1 mL

COG3, CT (COG3, SEC34, Conserved oligomeric Golgi complex subunit 3, Component of oligomeric Golgi complex 3, Vesicle-docking protein SEC34 homolog, p94) (MaxLight 405)

Sign In for Pricing
View Details
COG3, CT (COG3, SEC34, Conserved oligomeric Golgi complex subunit 3, Component of oligomeric Golgi complex 3, Vesicle-docking protein SEC34 homolog, p94) (MaxLight 405)
MBS6287531-02 5x 0.1 mL

COG3, CT (COG3, SEC34, Conserved oligomeric Golgi complex subunit 3, Component of oligomeric Golgi complex 3, Vesicle-docking protein SEC34 homolog, p94) (MaxLight 405)

Sign In for Pricing
View Details
NAPB (SNAPB, Beta-soluble NSF Attachment Protein, SNAP-BETA) (Biotin)
MBS6428192-01 0.1 mL

NAPB (SNAPB, Beta-soluble NSF Attachment Protein, SNAP-BETA) (Biotin)

Sign In for Pricing
View Details