Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH2 Rabbit Polyclonal Antibody (HRP)

ALKBH2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ABH2

UniProt

Q6NS38

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ALKBH2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Estrogen Receptor Alpha (ERa)
TRV-0035331-01 20 µL

Monoclonal Antibody to Estrogen Receptor Alpha (ERa)

Sign In for Pricing
View Details
Monoclonal Antibody to Estrogen Receptor Alpha (ERa)
TRV-0035331-02 100 µL

Monoclonal Antibody to Estrogen Receptor Alpha (ERa)

Sign In for Pricing
View Details
Monoclonal Antibody to Estrogen Receptor Alpha (ERa)
TRV-0035331-03 200 µL

Monoclonal Antibody to Estrogen Receptor Alpha (ERa)

Sign In for Pricing
View Details
Monoclonal Antibody to Estrogen Receptor Alpha (ERa)
TRV-0035331-04 1 mL

Monoclonal Antibody to Estrogen Receptor Alpha (ERa)

Sign In for Pricing
View Details
STAT 2 (Signal Transducer and Activator of Transcription 2) (FITC) discontinued
S7970-86-FITC 100 µL

STAT 2 (Signal Transducer and Activator of Transcription 2) (FITC) discontinued

Sign In for Pricing
View Details
TOMM22 antibody
70R-20919 50 μL

TOMM22 antibody

Sign In for Pricing
View Details