Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH2 Rabbit Polyclonal Antibody (Biotin)

ALKBH2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ABH2

UniProt

Q6NS38

Immunogen

The immunogen for Anti-ALKBH2 antibody is: synthetic peptide directed towards the C-terminal region of Human ALKB2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGAC

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methyl Aminolevulinate Hydrochloride
C10959-25mg 25 mg

Methyl Aminolevulinate Hydrochloride

Sign In for Pricing
View Details
ADAM17, CT (Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha cOnvertase, Snake Venom-like Protease, CD156b Antigen, CSVP, TACE) (MaxLight 405)
MBS6502002-01 0.1 mL

ADAM17, CT (Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha cOnvertase, Snake Venom-like Protease, CD156b Antigen, CSVP, TACE) (MaxLight 405)

Sign In for Pricing
View Details
ADAM17, CT (Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha cOnvertase, Snake Venom-like Protease, CD156b Antigen, CSVP, TACE) (MaxLight 405)
MBS6502002-02 5x 0.1 mL

ADAM17, CT (Disintegrin and Metalloproteinase Domain-containing Protein 17, TNF-alpha-converting Enzyme, TNF-alpha cOnvertase, Snake Venom-like Protease, CD156b Antigen, CSVP, TACE) (MaxLight 405)

Sign In for Pricing
View Details
Comb for 8 samples, multichannel, 0.75 mm thick
SPMN8MC-0.75 1 Unit

Comb for 8 samples, multichannel, 0.75 mm thick

Sign In for Pricing
View Details
Recombinant Escherichia coli dapD Protein (aa 1-274) (strain SE11)
VAng-Lsx02319-50gEcoli 50 µg (E. coli)

Recombinant Escherichia coli dapD Protein (aa 1-274) (strain SE11)

Sign In for Pricing
View Details
Lentiviral mouse Hivep3 shRNA (UAS) - Lentiviral mouse Hivep3 shRNA (UAS, GFP) (100)
GTR15131061 1 Vial

Lentiviral mouse Hivep3 shRNA (UAS) - Lentiviral mouse Hivep3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details