Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH2 Rabbit Polyclonal Antibody (FITC)

ALKBH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ABH2

UniProt

Q6NS38

Immunogen

The immunogen for Anti-ALKBH2 antibody is: synthetic peptide directed towards the C-terminal region of Human ALKB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGAC

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF405S conjugate, 0.1mg/mL
BNC042045-100 1x 100 µL

HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMS19 (NM_001289405) Human Tagged ORF Clone
RG239896 10 µg

MMS19 (NM_001289405) Human Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS503728 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Human DUOXA1 activation kit by CRISPRa
GA114032 1 Kit

Human DUOXA1 activation kit by CRISPRa

Sign In for Pricing
View Details
ScavengePore Benzenesulfonic acid, Na+-form
SC11011.100G 100 g

ScavengePore Benzenesulfonic acid, Na+-form

Sign In for Pricing
View Details
KIR3DL1 Rabbit Monoclonal Antibody [Clone ID: OTIR1A9]
TA594056S 30 µL

KIR3DL1 Rabbit Monoclonal Antibody [Clone ID: OTIR1A9]

Sign In for Pricing
View Details