Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALKBH2 Rabbit Polyclonal Antibody (FITC)

ALKBH2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ABH2

UniProt

Q6NS38

Immunogen

The immunogen for Anti-ALKBH2 antibody is: synthetic peptide directed towards the C-terminal region of Human ALKB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DHVSGVTGQTFNFVLINRYKDGCDHIGEHRDDERELAPGSPIASVSFGAC

Field of Research

Metabolism Research

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-9E3), Biotin conjugate, 0.1mg/mL
BNCB0010-500 1x 500 µL

MART-1 / Melan-A (M2-9E3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Lnpk activation kit by CRISPRa
GA208244 1 Kit

Mouse Lnpk activation kit by CRISPRa

Sign In for Pricing
View Details
MINA53 (MINA) Rabbit Polyclonal Antibody
TA370207 100 µL

MINA53 (MINA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Rectum
CS706722 5x 5 µm

Tissue FFPE Sections, Rectum

Sign In for Pricing
View Details
FRA2 (FOSL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B4]
TA809660AM 100 µL

FRA2 (FOSL2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B4]

Sign In for Pricing
View Details
G CSF (CSF3) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF810792 100 µg

G CSF (CSF3) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

Sign In for Pricing
View Details