Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTX2 Rabbit Polyclonal Antibody (HRP)

MTX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MDPS, metaxin-2

UniProt

Q8IZ68

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MTX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_001006636

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Bcl11a shRNA (UAS) - Lentiviral mouse Bcl11a shRNA (UAS, iRFP) plasmid
GTR15193444 1 Vial

Lentiviral mouse Bcl11a shRNA (UAS) - Lentiviral mouse Bcl11a shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
NGFR | p75NTR Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated
orb3000060 100 µL

NGFR | p75NTR Recombinant Rabbit mAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
Olr1365 3'UTR Luciferase Stable Cell Line
TU214666 1.0 mL

Olr1365 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PHKB Antibody
CSB-PA941946-01 50 μL

PHKB Antibody

Sign In for Pricing
View Details
PHKB Antibody
CSB-PA941946-02 100 µL

PHKB Antibody

Sign In for Pricing
View Details
Hamster Ovarian Cancer Immuno Reactive Antigen Domain Containing Protein 2 ELISA Kit
MBS092072-01 48 Well

Hamster Ovarian Cancer Immuno Reactive Antigen Domain Containing Protein 2 ELISA Kit

Sign In for Pricing
View Details