Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3, Human (EK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KIR2DL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl3-protein-human-hek-293-his.html

Smiles

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Formula

3804 (Gene_ID) P43628-1 (H22-H245) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefpodoxime Proxetil Isopropylcarbamate-d7
444143 2.5 mg

Cefpodoxime Proxetil Isopropylcarbamate-d7

Sign In for Pricing
View Details
Lentiviral human METAP2 sgRNA gene knockout kit - Lentiviral human METAP2 sgRNA gene knockout kit (25)
GTR15394422 1 Vial

Lentiviral human METAP2 sgRNA gene knockout kit - Lentiviral human METAP2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
UBE3A (Ubiquitin Protein Ligase E3A) Rabbit ELISA Kit
H9996 96 Tests

UBE3A (Ubiquitin Protein Ligase E3A) Rabbit ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TIAL1 shRNA (UAS) - Lentiviral human TIAL1 shRNA (UAS) (25)
GTR15088469 1 Vial

Lentiviral human TIAL1 shRNA (UAS) - Lentiviral human TIAL1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Human CD226 QuickTest ELISA Kit
QT-EH7177 96 Tests

Human CD226 QuickTest ELISA Kit

Sign In for Pricing
View Details
MALT1(MLT1, Mucosa-associated lymphoid tissue lymphoma translocation protein 1, Paracaspase 1) (MaxLight 405)
MBS6253022-01 0.1 mL

MALT1(MLT1, Mucosa-associated lymphoid tissue lymphoma translocation protein 1, Paracaspase 1) (MaxLight 405)

Sign In for Pricing
View Details