Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3, Human (EK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KIR2DL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl3-protein-human-hek-293-his.html

Smiles

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Formula

3804 (Gene_ID) P43628-1 (H22-H245) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

pH 4.5 Na Acetate Trihydrate acc USP - 1L
USP861 1 L

pH 4.5 Na Acetate Trihydrate acc USP - 1L

Sign In for Pricing
View Details
UHRF1 antibody
FNab09245 100 µg

UHRF1 antibody

Sign In for Pricing
View Details
Mouse Monoclonal Glutamine Synthetase Antibody (GLUL/6604) [Janelia Fluor 669]
NBP3-14039JF669 0.1 mL

Mouse Monoclonal Glutamine Synthetase Antibody (GLUL/6604) [Janelia Fluor 669]

Sign In for Pricing
View Details
Guinea pig interleukin 8, IL-8 ELISA Kit
SL0053Gp-01 96 Tests

Guinea pig interleukin 8, IL-8 ELISA Kit

Sign In for Pricing
View Details
Guinea pig interleukin 8, IL-8 ELISA Kit
SL0053Gp-02 48 Tests

Guinea pig interleukin 8, IL-8 ELISA Kit

Sign In for Pricing
View Details
GIMAP6 Protein Vector (Mouse) (pPB-C-His)
PV181978 500 ng

GIMAP6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details