Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3, Human (EK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KIR2DL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl3-protein-human-hek-293-his.html

Smiles

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Formula

3804 (Gene_ID) P43628-1 (H22-H245) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

APEX1 Antibody
A17412-50UG 50 µg

APEX1 Antibody

Sign In for Pricing
View Details
LINC00319 Human shRNA Lentiviral Particle (Locus ID 284836)
TL305918V 500 µL Each

LINC00319 Human shRNA Lentiviral Particle (Locus ID 284836)

Sign In for Pricing
View Details
GAB3, NT (GAB3, GRB2-associated-binding protein 3, GRB2-associated binder 3, Growth factor receptor bound protein 2-associated protein 3) (AP)
MBS6300686-01 0.2 mL

GAB3, NT (GAB3, GRB2-associated-binding protein 3, GRB2-associated binder 3, Growth factor receptor bound protein 2-associated protein 3) (AP)

Sign In for Pricing
View Details
GAB3, NT (GAB3, GRB2-associated-binding protein 3, GRB2-associated binder 3, Growth factor receptor bound protein 2-associated protein 3) (AP)
MBS6300686-02 5x 0.2 mL

GAB3, NT (GAB3, GRB2-associated-binding protein 3, GRB2-associated binder 3, Growth factor receptor bound protein 2-associated protein 3) (AP)

Sign In for Pricing
View Details
DiagPoly™ Plain Fluorescent Polystyrene Particles, Green, 0.09 µm
DFOA-L021 15 mL

DiagPoly™ Plain Fluorescent Polystyrene Particles, Green, 0.09 µm

Sign In for Pricing
View Details
Anti-B7-2/CD86 Antibody, Rabbit Polyclonal
MBS8126382-01 0.1 mL

Anti-B7-2/CD86 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details