Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3, Human (EK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KIR2DL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl3-protein-human-hek-293-his.html

Smiles

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Formula

3804 (Gene_ID) P43628-1 (H22-H245) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KRBOX4 Protein
E30P6909 20 µg

Recombinant Human KRBOX4 Protein

Sign In for Pricing
View Details
Phyhd1 Rat shRNA Plasmid (Locus ID 296621)
TR701831 1 Kit

Phyhd1 Rat shRNA Plasmid (Locus ID 296621)

Sign In for Pricing
View Details
Mouse Monoclonal FANCB Antibody (M38P3E10) [Allophycocyanin]
NBP2-52406APC 0.1 mL

Mouse Monoclonal FANCB Antibody (M38P3E10) [Allophycocyanin]

Sign In for Pricing
View Details
RYK CRISPRa sgRNA lentivector (set of three targets)(Rat)
42918126 3x 1.0µg DNA

RYK CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
FAM134C Protein Vector (Mouse) (pPB-N-His)
PV177299 500 ng

FAM134C Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human ZMYM1 Knockout A549 cell line
GTR15417313 1 Vial

Human ZMYM1 Knockout A549 cell line

Sign In for Pricing
View Details