Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL3, Human (EK293, His)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (HEK293, His) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

KIR2DL3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/kir2dl3-protein-human-hek-293-his.html

Smiles

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Formula

3804 (Gene_ID) P43628-1 (H22-H245) (Accession)

Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

B Raf (BRAF) Human shRNA Plasmid Kit (Locus ID 673)
TF320276 1 Kit

B Raf (BRAF) Human shRNA Plasmid Kit (Locus ID 673)

Sign In for Pricing
View Details
Rabbit Monoclonal Substance P Antibody (SR2325)
NBP3-27852-100ul 100 µL

Rabbit Monoclonal Substance P Antibody (SR2325)

Sign In for Pricing
View Details
Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit
EKL62380 96 Tests

Human Procollagen I N-Terminal Propeptide (PINP) ELISA Kit

Sign In for Pricing
View Details
Pkdcc ORF Vector (Mouse) (pORF)
ORF054130 1.0 µg DNA

Pkdcc ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-TIMM22 Antibody (7S201)
MF-0090583-01 25 µL

Anti-TIMM22 Antibody (7S201)

Sign In for Pricing
View Details
Anti-TIMM22 Antibody (7S201)
MF-0090583-02 50 µL

Anti-TIMM22 Antibody (7S201)

Sign In for Pricing
View Details