Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhdc9 Rabbit Polyclonal Antibody (Biotin)

Klhdc9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ESTM3, ESTM31, AA087357, 1190002J23Rik

UniProt

Q3USL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HHSCSVVGPFAVLFGGETLTRARDTICNDLYIYDTRKSPPLWFHFPSTDR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001028211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated
TNFSF11-322HAF647 20 μg- 50 μg- 100 μg

Recombinant Human TNFSF11 Protein, Fc-tagged, Alexa Fluor 647 conjugated

Sign In for Pricing
View Details
HIPK3, CT (HIPK3, DYRK6, FIST3, PKY, Homeodomain-interacting protein kinase 3, Androgen receptor-interacting nuclear protein kinase, Fas-interacting serine/threonine-protein kinase, Homolog of protein kinase YAK1)
036568 200 µL

HIPK3, CT (HIPK3, DYRK6, FIST3, PKY, Homeodomain-interacting protein kinase 3, Androgen receptor-interacting nuclear protein kinase, Fas-interacting serine/threonine-protein kinase, Homolog of protein kinase YAK1)

Sign In for Pricing
View Details
Peripheral Myelin Protein 22 (PMP22) Antibody
abx239981 100 µg

Peripheral Myelin Protein 22 (PMP22) Antibody

Sign In for Pricing
View Details
Human ZNF530 Pre-designed siRNA Set A
SI018879A 1 Each

Human ZNF530 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Slc35b1 (NM_016752) Mouse Tagged ORF Clone Lentiviral Particle
MR204665L4V 200 µL

Slc35b1 (NM_016752) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Real Time PCR test for Acinetobacter spp resistance to carbapenems, penicillins and cephalosporins, genes blaOXA40 (0,2 mL tube format)
T01962-50-T 60 Tests

Real Time PCR test for Acinetobacter spp resistance to carbapenems, penicillins and cephalosporins, genes blaOXA40 (0,2 mL tube format)

Sign In for Pricing
View Details