Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYSFIP1 Rabbit Polyclonal Antibody (Biotin)

DYSFIP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DYSFIP1

UniProt

Q86WC6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DYSFIP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007534

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST3 Protein Lysate (Rat) with C-HA Tag
16977036 100 µg

CST3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O8 (strain IAI1) rplN Polyclonal Antibody
MBS7174644 Inquire

Rabbit anti-Escherichia coli O8 (strain IAI1) rplN Polyclonal Antibody

Sign In for Pricing
View Details
TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)
MBS6503917-01 0.2 mL

TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)

Sign In for Pricing
View Details
TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)
MBS6503917-02 5x 0.2 mL

TPH1, NT (Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase 1, TRPH, TPRH, TPH) (PE)

Sign In for Pricing
View Details
MAP3K5 Rabbit pAb
E45R17395N-100 100 µL

MAP3K5 Rabbit pAb

Sign In for Pricing
View Details
TIM 1 Rabbit Monoclonal Antibody, 1 pack = 100 µL
BAL5103 1 Each

TIM 1 Rabbit Monoclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details