Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYSFIP1 Rabbit Polyclonal Antibody (HRP)

DYSFIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DYSFIP1

UniProt

Q86WC6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DYSFIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CSDGYPDIARYLISLGADRDATNDDGDLPSDLIDPDYKELVELFKGTTMD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007534

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nr5a1 shRNA (UAS) - Lentiviral mouse Nr5a1 shRNA (UAS, GFP) (100)
GTR15197349 1 Vial

Lentiviral mouse Nr5a1 shRNA (UAS) - Lentiviral mouse Nr5a1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Heat Shock Protein 70 (HSP70) BioAssayTM ELISA Kit (Bovine, Goat and Sheep) discontinued
366083 96 Tests

Heat Shock Protein 70 (HSP70) BioAssayTM ELISA Kit (Bovine, Goat and Sheep) discontinued

Sign In for Pricing
View Details
PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)
MBS6430608-01 0.1 mL

PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)

Sign In for Pricing
View Details
PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)
MBS6430608-02 5x 0.1 mL

PATE3 (Prostate and Testis Expressed Protein 3, HEL-127, PATE-DJ) (MaxLight 750)

Sign In for Pricing
View Details
P-Chlorophenylthioacetic acid
C18145-01 5 g

P-Chlorophenylthioacetic acid

Sign In for Pricing
View Details
P-Chlorophenylthioacetic acid
C18145-02 25 g

P-Chlorophenylthioacetic acid

Sign In for Pricing
View Details