Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cct7 Rabbit Polyclonal Antibody (FITC)

Cct7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ccth, Cctz, AA408524, AL022769

UniProt

P80313

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_031664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Tetratricopeptide repeat protein 27 (Ttc27), partial
MBS1307694 Inquire

Recombinant Mouse Tetratricopeptide repeat protein 27 (Ttc27), partial

Sign In for Pricing
View Details
Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit
MBS9910211-01 48 Well

Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit

Sign In for Pricing
View Details
Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit
MBS9910211-02 96 Well

Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit

Sign In for Pricing
View Details
Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit
MBS9910211-03 5x 96 Well

Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit

Sign In for Pricing
View Details
Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit
MBS9910211-04 10x 96 Well

Rat Serrate RNA Effector Molecule Homolog (SRRT) ELISA Kit

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)
MBS2095145-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Ribonuclease L (RNASEL)

Sign In for Pricing
View Details