Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PM20D2 Rabbit Polyclonal Antibody (HRP)

PM20D2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACY1L2

UniProt

Q8IYS1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PM20D2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HGIIKNGGVKPNIIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001010853

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL3P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1873008 1.0 µg DNA

RPL3P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit anti-human chromobox homolog 1 (HP1 beta homolog Drosophila) polyclonal Antibody
MBS713665-01 0.1 mL

Rabbit anti-human chromobox homolog 1 (HP1 beta homolog Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human chromobox homolog 1 (HP1 beta homolog Drosophila) polyclonal Antibody
MBS713665-02 5x 0.1 mL

Rabbit anti-human chromobox homolog 1 (HP1 beta homolog Drosophila) polyclonal Antibody

Sign In for Pricing
View Details
RPS23 Antibody
ABD3682 100 µg

RPS23 Antibody

Sign In for Pricing
View Details
N Cadherin (CDH2) (NM_001792) Human Over-expression Lysate
E45H05862-2 20 µg

N Cadherin (CDH2) (NM_001792) Human Over-expression Lysate

Sign In for Pricing
View Details
MARCH8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1270108 1.0 µg DNA

MARCH8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details