Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPJ Rabbit Polyclonal Antibody (HRP)

LIPJ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LIPL1, bA425M17.2

UniProt

Q5W064

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LIPJ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKK1 Human Gene Knockout Kit (CRISPR)
KN400094 1 Kit

DKK1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human STAU2 activation kit by CRISPRa
GA108987 1 Kit

Human STAU2 activation kit by CRISPRa

Sign In for Pricing
View Details
Histone H1 (Pan Nuclear Marker) (N/A), Biotin conjugate, 0.1mg/mL
BNCB1816-100 1x 100 µL

Histone H1 (Pan Nuclear Marker) (N/A), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IGF1 Receptor (IGF1R) Human Gene Knockout Kit (CRISPR)
KN214928RB 1 Kit

IGF1 Receptor (IGF1R) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NFKB1 pSer927 Rabbit Polyclonal Antibody
AP08022PU-N 100 µL

NFKB1 pSer927 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Fumaric Acid Monoethyl-d5 Ester
TRC-F500387-10MG 10 mg

Fumaric Acid Monoethyl-d5 Ester

Sign In for Pricing
View Details