Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPJ Rabbit Polyclonal Antibody (HRP)

LIPJ Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LIPL1, bA425M17.2

UniProt

Q5W064

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LIPJ

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNLVHYNQTTSPLYNMTNMNVATAIWNGKSDLLADPEDVNILHSEITNHI

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010939

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelin 1 Recombinant Rabbit monoclonal Antibody
HA723770 100 µL

Endothelin 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS510337 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
LY6G6C (C-term) Rabbit Polyclonal Antibody
AP52564PU-N 400 µL

LY6G6C (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TORC1 (CRTC1) Rabbit Polyclonal Antibody
TA375110 100 µL

TORC1 (CRTC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human RGPD6 activation kit by CRISPRa
GA119017 1 Kit

Human RGPD6 activation kit by CRISPRa

Sign In for Pricing
View Details
CYP1A1 (NM_000499) Human Over-expression Lysate
LC400170 20 µg

CYP1A1 (NM_000499) Human Over-expression Lysate

Sign In for Pricing
View Details