Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Asb11 Rabbit Polyclonal Antibody (HRP)

Asb11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1566298

UniProt

D3ZSF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGDYICHTFQGDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLVTINRV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M-01 20 Tests

Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M-02 100 Tests

Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]
E-AB-F1236M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD16 Antibody[3G8]

Sign In for Pricing
View Details
KIAA0284 (CEP170B) Human Gene Knockout Kit (CRISPR)
KN416904 1 Kit

KIAA0284 (CEP170B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF647 conjugate, 0.1mg/mL
BNC470418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS716904 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details