Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAL Rabbit Polyclonal Antibody (Biotin)

ADAL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HsMAPDA

UniProt

Q6DHV7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit
MBS2890136-01 48 Well

Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit
MBS2890136-02 96 Well

Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit
MBS2890136-03 5x 96 Well

Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit
MBS2890136-04 10x 96 Well

Human MAST1/Microtubule-Associated Serine/Threonine-Protein Kinase 1 ELISA Kit

Sign In for Pricing
View Details
Chromosomal replication initiator protein DnaA
PX-P4506-01 50 µg

Chromosomal replication initiator protein DnaA

Sign In for Pricing
View Details
Chromosomal replication initiator protein DnaA
PX-P4506-02 100 µg

Chromosomal replication initiator protein DnaA

Sign In for Pricing
View Details