Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAL Rabbit Polyclonal Antibody (HRP)

ADAL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HsMAPDA

UniProt

Q6DHV7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ADAL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILLDLLPDRIGHGTFLNSGEGGSLDLVDFVRQHRIPLELCLTSNVKSQTV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome alpha 6 Rabbit mAb
52528 50 µL

Proteasome alpha 6 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Otolemur crassicaudatus Rhodopsin (RHO), partial
MBS7056856 Inquire

Recombinant Otolemur crassicaudatus Rhodopsin (RHO), partial

Sign In for Pricing
View Details
PDK2, CT (PDK2, PDHK2, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2) (Biotin) discontinued
039843-Biotin 200 µL

PDK2, CT (PDK2, PDHK2, [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial, Pyruvate dehydrogenase kinase isoform 2) (Biotin) discontinued

Sign In for Pricing
View Details
Human Elastin (ELN) Antibody Pair Kit (with Standard)
MBS2090126-01 5x 96 Tests

Human Elastin (ELN) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Elastin (ELN) Antibody Pair Kit (with Standard)
MBS2090126-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Elastin (ELN) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Elastin (ELN) Antibody Pair Kit (with Standard)
MBS2090126-03 10x 96 Tests

Human Elastin (ELN) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details