Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf28 Rabbit Polyclonal Antibody (Biotin)

C14orf28 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DRIP1, DRIP-1, c14_5270

UniProt

Q4W4Y0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf28

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFTKNLENLMSTI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001017923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SGF29 shRNA (UAS) - Lentiviral human SGF29 shRNA (UAS, GFP) (25)
GTR15329723 1 Vial

Lentiviral human SGF29 shRNA (UAS) - Lentiviral human SGF29 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis UPF0458 protein C7orf42 homolog
orb2926674-01 20 µg

Recombinant Xenopus tropicalis UPF0458 protein C7orf42 homolog

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis UPF0458 protein C7orf42 homolog
orb2926674-02 100 µg

Recombinant Xenopus tropicalis UPF0458 protein C7orf42 homolog

Sign In for Pricing
View Details
Lentiviral human LGR4 shRNA (UAS) - Lentiviral human LGR4 shRNA (UAS, RFP) (100)
GTR15305067 1 Vial

Lentiviral human LGR4 shRNA (UAS) - Lentiviral human LGR4 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
NEK9, CT (NIMA (Never in Mitosis Gene A) -Related Kinase 9, Never in Mitosis A-related Kinase 9, NIMA-related Kinase Nek9, NimA-related Protein Kinase 9, DKFZp434D0935, HGNC:18591, KIAA1995, MGC138306, MGC16714, Nercc1 Kinase, NERCC1, NERCC, NIMA-related Kinase Nek8, Nek8, Serine/threonine Protein Kinase Nek9) (MaxLight 750) discontinued
N0800-09E-ML750 100 µL

NEK9, CT (NIMA (Never in Mitosis Gene A) -Related Kinase 9, Never in Mitosis A-related Kinase 9, NIMA-related Kinase Nek9, NimA-related Protein Kinase 9, DKFZp434D0935, HGNC:18591, KIAA1995, MGC138306, MGC16714, Nercc1 Kinase, NERCC1, NERCC, NIMA-related Kinase Nek8, Nek8, Serine/threonine Protein Kinase Nek9) (MaxLight 750) discontinued

Sign In for Pricing
View Details
CCT3 Antibody
RQ4525 100 µg

CCT3 Antibody

Sign In for Pricing
View Details