Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14orf28 Rabbit Polyclonal Antibody (HRP)

C14orf28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRIP1, DRIP-1, c14_5270

UniProt

Q4W4Y0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C14orf28

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FTTVKLLWIWDKMEKQQYKSEVHKASLIIDLFGNEHDNFTKNLENLMSTI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001017923

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS8 CRISPR Activation Plasmid (h2)
sc-410905-ACT-2 20 µg

NDUFS8 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Mouse VEGF144
MBS691941-01 0.002 mg

Mouse VEGF144

Sign In for Pricing
View Details
Mouse VEGF144
MBS691941-02 5x 0.002 mg

Mouse VEGF144

Sign In for Pricing
View Details
Mir22 Mouse qPCR Template Standard (MI0000570)
MK300206 200 Reactions

Mir22 Mouse qPCR Template Standard (MI0000570)

Sign In for Pricing
View Details
TRNAF13P sgRNA CRISPR Lentivector (Human) (Target 1)
K2487502 1.0 µg DNA

TRNAF13P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rat Ectonucleoside triphosphate diphosphohydrolase 2, ENTPD2 ELISA Kit
MBS9332693-01 48 Well

Rat Ectonucleoside triphosphate diphosphohydrolase 2, ENTPD2 ELISA Kit

Sign In for Pricing
View Details