Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sorbs1 Rabbit Polyclonal Antibody (HRP)

Sorbs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C, CAP, Sh3d, Sh3d5, SH3P12, mKIAA1296, 2310065E01Rik, 9530001P15Rik

UniProt

D3Z5J3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Sorbs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_848139

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: L243]
AM26708PU-N 100 µg

HLA Class II DR Mouse Monoclonal Antibody [Clone ID: L243]

Sign In for Pricing
View Details
Human TMEM126B activation kit by CRISPRa
GA111029 1 Kit

Human TMEM126B activation kit by CRISPRa

Sign In for Pricing
View Details
Human Semaphorin 4A (SEMA4A) ELISA Kit
RD-SEMA4A-Hu-01 96 Tests

Human Semaphorin 4A (SEMA4A) ELISA Kit

Sign In for Pricing
View Details
Human Semaphorin 4A (SEMA4A) ELISA Kit
RD-SEMA4A-Hu-02 48 Tests

Human Semaphorin 4A (SEMA4A) ELISA Kit

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF488A conjugate, 0.1mg/mL
BNC880988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nandrolone 17-Propionate
TRC-N315050-2.5G 2.5 g

Nandrolone 17-Propionate

Sign In for Pricing
View Details