Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Csnk1a1 Rabbit Polyclonal Antibody (HRP)

Csnk1a1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CK1

UniProt

P97633

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Csnk1a1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FGDIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQGGVGIPHIR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_446067

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fatty Acid Desaturase 1 ELISA Kit
MBS085400-01 48 Well

Rat Fatty Acid Desaturase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fatty Acid Desaturase 1 ELISA Kit
MBS085400-02 96 Well

Rat Fatty Acid Desaturase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fatty Acid Desaturase 1 ELISA Kit
MBS085400-03 5x 96 Well

Rat Fatty Acid Desaturase 1 ELISA Kit

Sign In for Pricing
View Details
Rat Fatty Acid Desaturase 1 ELISA Kit
MBS085400-04 10x 96 Well

Rat Fatty Acid Desaturase 1 ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9358754-01 48 Well

Mouse DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details
Mouse DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit
MBS9358754-02 96 Well

Mouse DNA Damage-Inducible Transcript 4-Like Protein (DDIT4L) ELISA Kit

Sign In for Pricing
View Details