Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC17 Rabbit Polyclonal Antibody (Biotin)

LRRC17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P37NB

UniProt

Q8N6Y2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LRRC17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005815

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (MaxLight 405) discontinued
301346-ML405 100 µL

DR5 (TRAIL Receptor 2, KILLER, TRAIL Receptor-2, TRICK2A, Soluble TRAIL Receptor-2, TRAIL R2, TRICKB, TNFRSF10B, Apo-2L) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rat Absent in melanoma 2, AIM2 ELISA Kit
MBS1611705-01 48 Well

Rat Absent in melanoma 2, AIM2 ELISA Kit

Sign In for Pricing
View Details
Rat Absent in melanoma 2, AIM2 ELISA Kit
MBS1611705-02 96 Well

Rat Absent in melanoma 2, AIM2 ELISA Kit

Sign In for Pricing
View Details
Rat Absent in melanoma 2, AIM2 ELISA Kit
MBS1611705-03 5x 96 Well

Rat Absent in melanoma 2, AIM2 ELISA Kit

Sign In for Pricing
View Details
Rat Absent in melanoma 2, AIM2 ELISA Kit
MBS1611705-04 10x 96 Well

Rat Absent in melanoma 2, AIM2 ELISA Kit

Sign In for Pricing
View Details
HEMK1 Rabbit Polyclonal Antibody (Biotin)
orb449370 100 µL

HEMK1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details