Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC17 Rabbit Polyclonal Antibody (HRP)

LRRC17 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P37NB

UniProt

Q8N6Y2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LRRC17

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001026862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL-18 Recombinant Rabbit Monoclonal Antibody [PSH02-08]
HA721767 100 µL

Human IL-18 Recombinant Rabbit Monoclonal Antibody [PSH02-08]

Sign In for Pricing
View Details
Samt3 Mouse Gene Knockout Kit (CRISPR)
KN515286 1 Kit

Samt3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF405S conjugate, 0.1mg/mL
BNC042717-500 1x 500 µL

PAPP-A / Pappalysin-1 (Marker of Atherosclerosis and Aneuploid Fetus) (PAPPA/2717), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KPI2 (LMTK2) Rabbit Polyclonal Antibody
AP13773PU-N 400 µL

KPI2 (LMTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP14 Human Knockdown Lysate
LY300243 100 µg

MMP14 Human Knockdown Lysate

Sign In for Pricing
View Details
HIST1H2AK (HIST1H2AM) (NM_003514) Human Over-expression Lysate
LY401183 100 µg

HIST1H2AK (HIST1H2AM) (NM_003514) Human Over-expression Lysate

Sign In for Pricing
View Details