Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDM1 Rabbit Polyclonal Antibody (FITC)

RDM1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAD52B

UniProt

A8MY68

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RDM1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NSSKCQELANYYFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001030008

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rho guanine exchange factor 16 Rabbit Polyclonal Antibody (BF488)
orb2464820 100 µL

Rho guanine exchange factor 16 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CT (Calcitonin) BioAssayTM ELISA Kit (Rat) discontinued
355013-01 48 Tests

CT (Calcitonin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
CT (Calcitonin) BioAssayTM ELISA Kit (Rat) discontinued
355013-02 96 Tests

CT (Calcitonin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Thumpd3 3'UTR GFP Stable Cell Line
TU170477 1.0 mL

Thumpd3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PARP1, Catalytic domain, Recombinant, Human, aa656-1014, His-Tag (Poly [ADP-ribose] Polymerase 1, PARP-1, NAD (+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] Synthase 1, ADPRT, PPOL) discontinued
207327 20 µg

PARP1, Catalytic domain, Recombinant, Human, aa656-1014, His-Tag (Poly [ADP-ribose] Polymerase 1, PARP-1, NAD (+) ADP-ribosyltransferase 1, ADPRT 1, Poly[ADP-ribose] Synthase 1, ADPRT, PPOL) discontinued

Sign In for Pricing
View Details
ARMC1 Protein Vector (Rat) (pPB-C-His)
PV254606 500 ng

ARMC1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details