Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pnck Rabbit Polyclonal Antibody (Biotin)

Pnck Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Pu, Bstk, Punc, Bstk3, Camk1, Camk1b, CaMKIbe, CaMKlb2, caMKlb1, CaMKIbeta2

UniProt

Q9QYK9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufs4 sgRNA CRISPR Lentivector set (Rat)
K6290501 3x 1.0 µg

Ndufs4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
FCGR1B Polyclonal Antibody
MBS9433183-01 0.05 mL

FCGR1B Polyclonal Antibody

Sign In for Pricing
View Details
FCGR1B Polyclonal Antibody
MBS9433183-02 0.1 mL

FCGR1B Polyclonal Antibody

Sign In for Pricing
View Details
FCGR1B Polyclonal Antibody
MBS9433183-03 5x 0.1 mL

FCGR1B Polyclonal Antibody

Sign In for Pricing
View Details
AFAP1, Recombinant, Human, aa250-588, His-Tag (Actin Filament Associated Protein 1, AFAP, AFAP-110)
217930-01 50 µg

AFAP1, Recombinant, Human, aa250-588, His-Tag (Actin Filament Associated Protein 1, AFAP, AFAP-110)

Sign In for Pricing
View Details
AFAP1, Recombinant, Human, aa250-588, His-Tag (Actin Filament Associated Protein 1, AFAP, AFAP-110)
217930-02 250 µg

AFAP1, Recombinant, Human, aa250-588, His-Tag (Actin Filament Associated Protein 1, AFAP, AFAP-110)

Sign In for Pricing
View Details