Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PROSER3 Rabbit Polyclonal Antibody (HRP)

PROSER3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C19orf55

UniProt

Q2NL68

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PROSER3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PSTTEGQMWASPAPTLIDSGDSVVAKYINRFRQAQPTSREERQPAGPTPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001034976.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EML1 Protein Vector (Human) (pPM-C-HA)
PV014207 500 ng

EML1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
FKBP10 (Peptidyl-prolyl Cis-trans Isomerase FKBP10, PPIase FKBP10, FK506-binding Protein 10, FKBP-10, Rotamase, Immunophilin FKBP65, 65kD FK506-binding Protein, FKBP-65, PSEC0056, FKBP65, FLJ20683, FLJ22041, FLJ23833)
140335 200 µL

FKBP10 (Peptidyl-prolyl Cis-trans Isomerase FKBP10, PPIase FKBP10, FK506-binding Protein 10, FKBP-10, Rotamase, Immunophilin FKBP65, 65kD FK506-binding Protein, FKBP-65, PSEC0056, FKBP65, FLJ20683, FLJ22041, FLJ23833)

Sign In for Pricing
View Details
Olr1509 ORF Vector (Rat) (pORF)
ORF072097 1.0 µg DNA

Olr1509 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
4-Iodo-N- (2-morpholin-4-yl-ethyl) -benzenesulfonamide
sc-357772A 100 mg

4-Iodo-N- (2-morpholin-4-yl-ethyl) -benzenesulfonamide

Sign In for Pricing
View Details
Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (PE) discontinued
U2281-02-PE 200 µL

Uridine Monophosphate Kinase 2, CT (Cytidine monophosphokinase 2, Testis-specific protein, UCK 2, UK, UMPK, Uridine-cytidine kinase 2, Uridine monophosphokinase 2) (PE) discontinued

Sign In for Pricing
View Details
Podocalyxin discontinued
512945 100 µg

Podocalyxin discontinued

Sign In for Pricing
View Details