Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM153B Rabbit Polyclonal Antibody (HRP)

FAM153B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp434D115

UniProt

P0C7A2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LOC202134

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VKKRVCFPSEDHLEEFIAEHLPEASNQSLLTVAHADTGIQTNGDLEDLEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001072997

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MAN2B1 shRNA Plasmid
abx971426-01 150 µg

Mouse MAN2B1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MAN2B1 shRNA Plasmid
abx971426-02 300 µg

Mouse MAN2B1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse Monoclonal Lambda Light Chain Antibody (1-155-2) [Janelia Fluor 646]
NBP1-79124JF646 0.1 mL

Mouse Monoclonal Lambda Light Chain Antibody (1-155-2) [Janelia Fluor 646]

Sign In for Pricing
View Details
PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (Biotin)
130882-Biotin 100 µL

PARK2 (E3 Ubiquitin-protein Ligase Parkin, PRKN, Parkinson Juvenile Disease Protein 2, Parkinson Disease Protein 2) (Biotin)

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa PA14_47450 Protein (aa 1-97)
VAng-Cr0581-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa PA14_47450 Protein (aa 1-97)

Sign In for Pricing
View Details
STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 550)
207900-ML550 100 µL

STK38 (Serine/Threonine Kinase 38, Ndr Ser/Thr Kinase-like Protein, OTTHUMP00000016293, Nuclear Dbf2-related 1, Serine Threonine Protein Kinase, NDR, NDR1) (MaxLight 550)

Sign In for Pricing
View Details