Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOM1L2 Rabbit Polyclonal Antibody (FITC)

TOM1L2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ32746

UniProt

Q6ZVM7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TOM1L2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPSVMDDIEVWLRTDLKGDDLEEGVTSEEFDKFLEERAKAAEMVPDLPSP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001076437

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit
MBS7202279-01 48 Well

Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit
MBS7202279-02 96 Well

Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit
MBS7202279-03 5x 96 Well

Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit

Sign In for Pricing
View Details
Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit
MBS7202279-04 10x 96 Well

Chicken Chromatin assembly factor 1 subunit B (CHAF1B) ELISA Kit

Sign In for Pricing
View Details
Phospho-RPS6KB1 (Ser434) Rabbit Polyclonal Antibody (BF488)
orb1604071 100 µL

Phospho-RPS6KB1 (Ser434) Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (APC)
MBS6423967-01 0.1 mL

KIT, Phosphorylated (Y721) (Steel Factor Receptor, Stem Cell Factor Receptor, PBT, SCFR, C-Kit, CD117) (APC)

Sign In for Pricing
View Details