Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Rabbit Polyclonal Antibody (FITC)

CTNND1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CTNND1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse F9 activation kit by CRISPRa
GA201344 1 Kit

Mouse F9 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS507861 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2710), CF640R conjugate, 0.1mg/mL
BNC402710-100 1x 100 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2710), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS631504 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Annexin V, CF®750 Conjugate (azide-free, lyophilized)
#29006 1x 25 µg

Annexin V, CF®750 Conjugate (azide-free, lyophilized)

Sign In for Pricing
View Details
Synaptotagmin 4 (SYT4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E10]
TA505846AM 100 µL

Synaptotagmin 4 (SYT4) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E10]

Sign In for Pricing
View Details