Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Rabbit Polyclonal Antibody (HRP)

CTNND1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120 (CAS), p120 (CTN)

UniProt

O60716

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CTNND1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001078927

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®647 IgM Antibody Labeling Kits, 1x25ug labeling
#92572 1 Kit

Mix-n-StainTM CF®647 IgM Antibody Labeling Kits, 1x25ug labeling

Sign In for Pricing
View Details
MVP Human Knockdown Lysate
LY300250 100 µg

MVP Human Knockdown Lysate

Sign In for Pricing
View Details
AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody
TA380328 100 µL

AMPK alpha 1 (PRKAA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SH3D19 (NM_001009555) Human Over-expression Lysate
LC432388 20 µg

SH3D19 (NM_001009555) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM25BP (NM_001137556) Human Over-expression Lysate
LY427938 100 µg

FAM25BP (NM_001137556) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TCF23 activation kit by CRISPRa
GA115771 1 Kit

Human TCF23 activation kit by CRISPRa

Sign In for Pricing
View Details