Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPA Rabbit Polyclonal Antibody (FITC)

COPA Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AILJK, HEP-COP, alpha-COP

UniProt

P53621

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human COPA

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDFHKQQPLFVSGGD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

135kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004362

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSTPIP1, NT (PSTPIP1, CD2BP1, Proline-serine-threonine phosphatase-interacting protein 1, CD2-binding protein 1, H-PIP) (MaxLight 750) discontinued
040580-ML750 100 µL

PSTPIP1, NT (PSTPIP1, CD2BP1, Proline-serine-threonine phosphatase-interacting protein 1, CD2-binding protein 1, H-PIP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)
MBS6347288-01 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)

Sign In for Pricing
View Details
SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)
MBS6347288-02 5x 0.2 mL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (FITC)

Sign In for Pricing
View Details
Lentiviral mouse Hamp shRNA (UAS) - Lentiviral mouseHamp shRNA (UAS, GFP) (25)
GTR15218624 1 Vial

Lentiviral mouse Hamp shRNA (UAS) - Lentiviral mouseHamp shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PAPPA Rabbit Polyclonal Antibody (APC-Cy7)
orb2399273 100 µL

PAPPA Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Aggrecan (AGC)
MBS2060488-01 0.1 mL

PE-Linked Polyclonal Antibody to Aggrecan (AGC)

Sign In for Pricing
View Details