Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L1 Rabbit Polyclonal Antibody (Biotin)

CHI3L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39

UniProt

P36222

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Porcine, Rabbit, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_001267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD150, phosphorylated (Tyr281) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM)
MBS631379-01 0.2 mL

CD150, phosphorylated (Tyr281) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM)

Sign In for Pricing
View Details
CD150, phosphorylated (Tyr281) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM)
MBS631379-02 5x 0.2 mL

CD150, phosphorylated (Tyr281) (Signaling Lymphocytic Activation Molecule, IPO-3, CDw150, SLAMF1, SLAM)

Sign In for Pricing
View Details
Pyruvate Carboxylase/PC Rabbit Polyclonal Antibody (APC)
orb2584765 100 µg

Pyruvate Carboxylase/PC Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
GENLISA Rat CD8a (Cluster Of Differentiation 8a) ELISA
KLR2783 1x 96 Well

GENLISA Rat CD8a (Cluster Of Differentiation 8a) ELISA

Sign In for Pricing
View Details
SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (Biotin) discontinued
042195-Biotin 200 µL

SPAG11A, NT (SPAG11A, EP2, HE2, Sperm-associated antigen 11A, Human epididymis-specific protein 2, Protein EP2, Sperm antigen HE2) (Biotin) discontinued

Sign In for Pricing
View Details
Staphylococcus aureus Malonyl CoA-acyl carrier Protein transacylase (fabD)
335680-01 50 µg

Staphylococcus aureus Malonyl CoA-acyl carrier Protein transacylase (fabD)

Sign In for Pricing
View Details