Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHI3L1 Rabbit Polyclonal Antibody (HRP)

CHI3L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GP39, ASRT7, GP-39, YK-40, YKL40, CGP-39, YKL-40, YYL-40, HC-gp39, HCGP-3P, hCGP-39

UniProt

P36222

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CHI3L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Porcine, Rabbit, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_001267

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human KLK3 shRNA (UAS) - Lentiviral human KLK3 shRNA (UAS, GFP) plasmid
GTR15307333 1 Vial

Lentiviral human KLK3 shRNA (UAS) - Lentiviral human KLK3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human CSNK2A1 sgRNA gene knockout kit - Lentiviral human CSNK2A1 sgRNA gene knockout kit (plasmid)
GTR15387713 1 Vial

Lentiviral human CSNK2A1 sgRNA gene knockout kit - Lentiviral human CSNK2A1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)
MBS2125138-01 0.1 mL

Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)

Sign In for Pricing
View Details
Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)
MBS2125138-02 0.2 mL

Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)

Sign In for Pricing
View Details
Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)
MBS2125138-03 0.5 mL

Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)

Sign In for Pricing
View Details
Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)
MBS2125138-04 1 mL

Monoclonal Antibody to Gamma-Glutamyl Hydrolase (gGH)

Sign In for Pricing
View Details