Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3S1 Rabbit Polyclonal Antibody (FITC)

AP3S1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CLAPS3, Sigma3A

UniProt

Q92572

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AP3S1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8423191-01 0.12 mL

Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8423191-02 0.2 mL

Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)
MBS8423191-03 5x 0.2 mL

Rabbit Anti CDC37 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3)(Western Blot)

Sign In for Pricing
View Details
Rat Apolipoprotein C-3, APOC3 ELISA KIT
EA0088Ra-01 96 Well

Rat Apolipoprotein C-3, APOC3 ELISA KIT

Sign In for Pricing
View Details
Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Tagged Lenti ORF Clone
RC204629L3 10 µg

Alpha 1 Acid Glycoprotein (ORM1) (NM_000607) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TPRA1 sgRNA CRISPR Lentivector set (Human)
K2813701 3x 1.0 µg

TPRA1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details