Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AP3S1 Rabbit Polyclonal Antibody (HRP)

AP3S1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLAPS3, Sigma3A

UniProt

Q92572

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human AP3S1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001275

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMRE, 2 mM solution in DMSO
#70005 1x 500 µL

TMRE, 2 mM solution in DMSO

Sign In for Pricing
View Details
PINX1 (225-237) Goat Polyclonal Antibody
AP10037PU-N 100 µg

PINX1 (225-237) Goat Polyclonal Antibody

Sign In for Pricing
View Details
MAGEA8 (NM_001166400) Human Over-expression Lysate
LC432878 20 µg

MAGEA8 (NM_001166400) Human Over-expression Lysate

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL
BNC041778-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL
BNC882970-500 1x 500 µL

MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cldn23 activation kit by CRISPRa
GA209012 1 Kit

Mouse Cldn23 activation kit by CRISPRa

Sign In for Pricing
View Details