Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1G2 Rabbit Polyclonal Antibody (FITC)

CSNK1G2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CK1g2

UniProt

P78368

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK1G2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001310

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITM2C Rabbit Polyclonal Antibody (Biotin)
orb2581150 100 µg

ITM2C Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CNTF Receptor alpha (CNTFR) (NM_001842) Human Tagged ORF Clone
RC212035 10 µg

CNTF Receptor alpha (CNTFR) (NM_001842) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)
MBS1403918-01 0.02 mg (E-Coli)

Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)

Sign In for Pricing
View Details
Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)
MBS1403918-02 0.02 mg (Yeast)

Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)

Sign In for Pricing
View Details
Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)
MBS1403918-03 0.1 mg (E-Coli)

Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)

Sign In for Pricing
View Details
Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)
MBS1403918-04 0.1 mg (Yeast)

Recombinant Mouse Probable RNA polymerase II nuclear localization protein SLC7A6OS (Slc7a6os)

Sign In for Pricing
View Details