Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1D Rabbit Polyclonal Antibody (HRP)

CSNK1D Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASPS, CKId, HCKID, FASPS2, CKIdelta, CKI-delta

UniProt

P48730

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK1D

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001884

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PIK3C2A Protein
E30P63023B 50 µg

Recombinant Human PIK3C2A Protein

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1214092-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1214092-02 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1214092-03 0.02 mg (Baculovirus)

Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1214092-04 0.02 mg (Mammalian-Cell)

Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)
MBS1214092-05 1 mg (E-Coli)

Recombinant Helicobacter pylori Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut)

Sign In for Pricing
View Details