Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1E Rabbit Polyclonal Antibody (Biotin)

CSNK1E Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CKIe, HCKIE, CKIepsilon

UniProt

P49674

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CSNK1E

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001885

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone 7D6]
E45M15339V-2 50 µL

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone 7D6]

Sign In for Pricing
View Details
hsa-let-7f-1-3p miRNA Agomir
MBS8311164-01 5 nmol

hsa-let-7f-1-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-let-7f-1-3p miRNA Agomir
MBS8311164-02 10 nmol

hsa-let-7f-1-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-let-7f-1-3p miRNA Agomir
MBS8311164-03 20 nmol

hsa-let-7f-1-3p miRNA Agomir

Sign In for Pricing
View Details
hsa-let-7f-1-3p miRNA Agomir
MBS8311164-04 5x 20 nmol

hsa-let-7f-1-3p miRNA Agomir

Sign In for Pricing
View Details
BRCA1 (Breast Cancer Type 1 Susceptibility Protein, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53)
214267 100 µL

BRCA1 (Breast Cancer Type 1 Susceptibility Protein, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53)

Sign In for Pricing
View Details