Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK2A1 Rabbit Polyclonal Antibody (Biotin)

CSNK2A1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CKII, Cka1, Cka2, CK2A1, OCNDS

UniProt

P68400

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK2A1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KChIP2 Antibody (KCNIP2/7589) [Alexa Fluor 488]
NBP3-24039AF488 0.1 mL

Mouse Monoclonal KChIP2 Antibody (KCNIP2/7589) [Alexa Fluor 488]

Sign In for Pricing
View Details
Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)
MBS2100886-01 5x 96 Tests

Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)
MBS2100886-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)
MBS2100886-03 10x 96 Tests

Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)
MBS2100886-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Porcine S100 Calcium Binding Protein A8 (S100A8) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
F4/80 CRISPR/Cas9 KO Plasmid (m)
sc-420168 20 µg

F4/80 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details