Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyc1 Rabbit Polyclonal Antibody (FITC)

Cyc1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cyct1, AA408921, 2610002H19Rik

UniProt

Q9D0M3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYTEVLEY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079843

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-708-3p miRNA Antagomir
CIS0326-01 10 nmol

Rno-miR-708-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-708-3p miRNA Antagomir
CIS0326-02 20 nmol

Rno-miR-708-3p miRNA Antagomir

Sign In for Pricing
View Details
TTBK1, ID (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (MaxLight 405)
MBS6359809-01 0.1 mL

TTBK1, ID (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (MaxLight 405)

Sign In for Pricing
View Details
TTBK1, ID (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (MaxLight 405)
MBS6359809-02 5x 0.1 mL

TTBK1, ID (TTBK1, BDTK, KIAA1855, Tau-tubulin kinase 1, Brain-derived tau kinase) (MaxLight 405)

Sign In for Pricing
View Details
Tucidinostat (Chidamide)
S8567-1g 1 g

Tucidinostat (Chidamide)

Sign In for Pricing
View Details
JCHAIN Recombinant Rabbit Monoclonal Antibody
orb1152018-01 25 µL

JCHAIN Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details