Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp7 Rabbit Polyclonal Antibody (Biotin)

Dusp7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mkp-X

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_238551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIT1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-17134R-BF350 100 µL

TRIT1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CYP11B2 Recombinant Protein Antigen
NBP2-13891PEP 0.1 mL

CYP11B2 Recombinant Protein Antigen

Sign In for Pricing
View Details
Rabbit anti-LZK Antibody
MBS4512114-01 0.05 mL

Rabbit anti-LZK Antibody

Sign In for Pricing
View Details
Rabbit anti-LZK Antibody
MBS4512114-02 0.1 mL

Rabbit anti-LZK Antibody

Sign In for Pricing
View Details
Rabbit anti-LZK Antibody
MBS4512114-03 5x 0.1 mL

Rabbit anti-LZK Antibody

Sign In for Pricing
View Details
Gamma Tubulin Monoclonal Antibody
E53M02705 100 µL

Gamma Tubulin Monoclonal Antibody

Sign In for Pricing
View Details