Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp7 Rabbit Polyclonal Antibody (FITC)

Dusp7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Mkp-X

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_238551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2) (MaxLight 650)
MBS6223726-01 0.1 mL

PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2) (MaxLight 650)

Sign In for Pricing
View Details
PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2) (MaxLight 650)
MBS6223726-02 5x 0.1 mL

PCTP (STARD2, Phosphatidylcholine Transfer Protein, START Domain-containing Protein 2, StAR-related Lipid Transfer Protein 2) (MaxLight 650)

Sign In for Pricing
View Details
Human HMOX2 Pre-designed siRNA Set B
SI007143B 1 Each

Human HMOX2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
BFSP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0182107 1.0 µg DNA

BFSP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human N-Sulfoglucosamine Sulfohydrolase (SGSH) ELISA Kit
RD-SGSH-Hu-01 96 Tests

Human N-Sulfoglucosamine Sulfohydrolase (SGSH) ELISA Kit

Sign In for Pricing
View Details
Human N-Sulfoglucosamine Sulfohydrolase (SGSH) ELISA Kit
RD-SGSH-Hu-02 48 Tests

Human N-Sulfoglucosamine Sulfohydrolase (SGSH) ELISA Kit

Sign In for Pricing
View Details