Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dusp7 Rabbit Polyclonal Antibody (HRP)

Dusp7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mkp-X

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_238551

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (AP) discontinued
251228-AP 100 µL

RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (AP) discontinued

Sign In for Pricing
View Details
Human single stranded DNA Antibody, ssDNA ELISA Kit
MBS9302674-01 48 Well

Human single stranded DNA Antibody, ssDNA ELISA Kit

Sign In for Pricing
View Details
Human single stranded DNA Antibody, ssDNA ELISA Kit
MBS9302674-02 96 Well

Human single stranded DNA Antibody, ssDNA ELISA Kit

Sign In for Pricing
View Details
Human single stranded DNA Antibody, ssDNA ELISA Kit
MBS9302674-03 5x 96 Well

Human single stranded DNA Antibody, ssDNA ELISA Kit

Sign In for Pricing
View Details
Human single stranded DNA Antibody, ssDNA ELISA Kit
MBS9302674-04 10x 96 Well

Human single stranded DNA Antibody, ssDNA ELISA Kit

Sign In for Pricing
View Details
Human Kallikrein 5 (KLK5) ELISA Kit
MBS2019146-01 24 Strip Well

Human Kallikrein 5 (KLK5) ELISA Kit

Sign In for Pricing
View Details