Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ela1 Rabbit Polyclonal Antibody (HRP)

Ela1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

El, Ela, Ela1, PC-T, Ela-1, PC-TsF, 1810009A17Rik, 1810062B19Rik

UniProt

Q91X79

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGYDIALLRLAKSV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_291090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orbi-Shaker™ CO2 XL orbital shaker with flat mat platform, 230V
BT4011-E 1 Each

Orbi-Shaker™ CO2 XL orbital shaker with flat mat platform, 230V

Sign In for Pricing
View Details
(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol Hydrochloride
TRC-A622675-1G 1 g

(R)-2-((4-Aminophenethyl)amino)-1-phenylethanol Hydrochloride

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: bilateral
CP565816 150 µg

Tissue Protein Lysate, Ovary: bilateral

Sign In for Pricing
View Details
Olpadronic Acid Ammonium Salt
TRC-O575300-1G 1 g

Olpadronic Acid Ammonium Salt

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF488A conjugate, 0.1mg/mL
BNC882007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human TMEM208 activation kit by CRISPRa
GA109233 1 Kit

Human TMEM208 activation kit by CRISPRa

Sign In for Pricing
View Details